GTX46808
SLC35C1 antibody, N-term
Cannot supply to this region.
- SKU:
- GTX46808
- Additional Names:
- solute carrier family 35 member C1 , CDG2C , FUCT1
- Application:
- WB
- Concentration:
- 0.5-1 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human
- Purification:
- Protein A Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Human
- Buffer:
- PBS, 2% Sucrose, 0.09% Sodium azide.
- Immunogen:
- A synthetic peptide corresponding to a N-terminal region of Human SLC35C1: TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG
- Uniprot:
- Q96A29
- Synonyms:
- CDG2C;FUCT1;GDP-fucose transporter 1;solute carrier family 35 (GDP-fucose transporter), member C1;Solute carrier family 35 member C1
- Extra Details:
- This gene encodes a GDP-fucose transporter that is found in the Golgi apparatus. Mutations in this gene result in congenital disorder of glycosylation type IIc. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009]
- Shipping Conditions:
- Blue Ice