AMH antibody [5/6]

Cannot supply to this region.

SKU:: GTX42794
Additional Names:: anti-Mullerian hormone , MIF , MIS
Application:: IHC, WB, IHC-P
Physical State:: Liquid
Species Reactivity:: Human
Purification:: Crude Cell Culture Supernatant
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
Supplier:: Genetex
Host:: Mouse
Reactivities:: Human, Mouse, Rat, Ovine
Buffer:: Tissue culture supernatant, 0.1% Sodium azide.
Immunogen:: Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
Clone:: 5/6
Uniprot:: P03971
Synonyms:: anti-Muellerian hormone;MIF;MIS;muellerian-inhibiting factor;muellerian-inhibiting substance;Mullerian inhibiting factor;Mullerian inhibiting substance
Extra Details:: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate N- and C-terminal cleavage products that homodimerize and associate to form a biologically active noncovalent complex. This complex binds to the anti-Mullerian hormone receptor type 2 and causes the regression of Mullerian ducts in the male embryo that would otherwise differentiate into the uterus and fallopian tubes. This protein also plays a role in Leydig cell differentiation and function and follicular development in adult females. Mutations in this gene result in persistent Mullerian duct syndrome. [provided by RefSeq, Jul 2016]

Shipping Conditions:: Blue Ice