MAP3K1 antibody [2F6]

Cannot supply to this region.

SKU:: GTX34816
Additional Names:: MAP3K1 , MAPKKK1 , MEKK , MEKK 1 , MEKK1 , SRXY6 , mitogenactivated protein kinase kinase kinase 1 , MEK kinase-1 , mitogen-activated protein kinase kinase kinase 1
Application:: WB, IHC-P
Concentration:: 0.2 mg/ml
Physical State:: Liquid
Species Reactivity:: Human
Purification:: protein a/g purified
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
Supplier:: Genetex
Host:: Mouse
Reactivities:: Human
Buffer:: PBS, 0.05% BSA, 0.05% Sodium azide.
Immunogen:: Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Clone:: 2F6
Uniprot:: Q13233
Synonyms:: MAP/ERK kinase kinase 1;MAPK/ERK kinase kinase 1;MAPKKK1;MEK kinase 1;MEKK;MEKK 1;MEKK1;mitogen-activated protein kinase kinase kinase 1;mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase;SRXY6
Extra Details:: The protein encoded by this gene is a serine/threonine kinase and is part of some signal transduction cascades, including the ERK and JNK kinase pathways as well as the NF-kappa-B pathway. The encoded protein is activated by autophosphorylation and requires magnesium as a cofactor in phosphorylating other proteins. This protein has E3 ligase activity conferred by a plant homeodomain (PHD) in its N-terminus and phospho-kinase activity conferred by a kinase domain in its C-terminus. [provided by RefSeq, Mar 2012]

Shipping Conditions:: Blue Ice