GTX21654
TLR5 antibody
Cannot supply to this region.
- SKU:
- GTX21654
- Additional Names:
- MELIOS,SLE1,SLEB1,TIL3,TLR5,toll like receptor 5
- Application:
- ELISA, Flow Cytometry, WB, IHC-P
- Concentration:
- 1 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Goat
- Reactivities:
- Human, Mouse
- Buffer:
- 10mM KHPO₄, 140mM NaCl, 0.1% BSA, 0.1% Sodium azide.
- Immunogen:
- Synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to aa 151-181 of human TLR5
- Uniprot:
- O60602
- Synonyms:
- MELIOS;SLE1;SLEB1;systemic lupus erythematosus susceptibility 1;TIL3;toll-like receptor 5;toll/interleukin-1 receptor-like protein 3
- Extra Details:
- This gene encodes a member of the toll-like receptor (TLR) family, which plays a fundamental role in pathogen recognition and activation of innate immune responses. These receptors recognize distinct pathogen-associated molecular patterns that are expressed on infectious agents. The protein encoded by this gene recognizes bacterial flagellin, the principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB, which in turn activates a host of inflammatory-related target genes. Mutations in this gene have been associated with both resistance and susceptibility to systemic lupus erythematosus, and susceptibility to Legionnaire disease.[provided by RefSeq, Dec 2009]
- Shipping Conditions:
- Blue Ice