GTX18566
IL22 Receptor alpha 2 antibody
Cannot supply to this region.
- SKU:
- GTX18566
- Additional Names:
- CRF210,CRF2S1,CRF2X,IL22BP,IL22RA2,IL22Ralpha2,ZCYTOR16,interleukin 22 receptor subunit alpha 2,IL22 Receptor alpha 2
- Application:
- ELISA, IHC-P
- Concentration:
- 1 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Goat
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- 10mM KHPO₄, 140mM NaCl, 0.1% BSA, 0.1% Sodium azide.
- Immunogen:
- Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein
- Uniprot:
- Q969J5
- Synonyms:
- CRF2-10;CRF2-S1;CRF2X;cytokine receptor class-II member 10;Cytokine receptor family 2 member 10;cytokine receptor family type 2, soluble 1;IL-22BP;IL-22R-alpha-2;IL-22RA2;interleukin 22 receptor, alpha 2;interleukin 22-binding protein;interleukin-22 receptor subunit alpha-2;Interleukin-22-binding protein;ZCYTOR16
- Extra Details:
- This gene encodes a member of the class II cytokine receptor family. The encoded soluble protein specifically binds to and inhibits interleukin 22 activity by blocking the interaction of interleukin 22 with its cell surface receptor. The encoded protein may be important in the regulation of inflammatory response, and has been implicated in the regulation of tumorigenesis in the colon. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2013]
- Shipping Conditions:
- Blue Ice