GTX17693
NTCP antibody
Cannot supply to this region.
- SKU:
- GTX17693
- Additional Names:
- solute carrier family 10 (sodium/bile acid cotransporter family), member 1 , Ntcp
- Application:
- Flow Cytometry, WB, IHC-P, IHC-Fr
- Concentration:
- 500 ug/ml
- Physical State:
- Liquid
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Buffer:
- 0.1% Na₂HPO₄, 0.45% NaCl, 2.5% BSA, 0.025% Sodium azide.
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296-336aa EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK), different from the related human sequence by eighteen amino acids, and from the related rat sequence by three amino acids.
- Uniprot:
- O08705
- Synonyms:
- bile acid cotransporting polypeptide;Na(+)/bile acid cotransporter;Na(+)/taurocholate transport protein;Nt;Ntcp;sodium bile acid cotransporting polypeptide;sodium-taurocholate cotransporting polypeptide;sodium/bile acid cotransporter;Sodium/taurocholate cotransporting polypeptide;Solute carrier family 10 member 1
- Shipping Conditions:
- Blue Ice