GTX17572
GPM6A antibody
Cannot supply to this region.
- SKU:
- GTX17572
- Additional Names:
- glycoprotein M6A , GPM6 , M6A
- Application:
- WB, IF, ICC
- Concentration:
- 0.5-1 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Buffer:
- PBS, 2% Sucrose, 0.09% Sodium azide.
- Immunogen:
- Synthetic peptide located within the following region: IAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLN
- Uniprot:
- P51674
- Synonyms:
- GPM6;M6A;neuronal membrane glycoprotein M6-a
- Shipping Conditions:
- Blue Ice