GTX17554
A2BP1 antibody

Cannot supply to this region.
- SKU:
- GTX17554
- Additional Names:
- RNA binding fox-1 homolog 1 , 2BP1 , A2BP1 , FOX-1 , FOX1 , HRNBP1
- Application:
- WB
- Concentration:
- 0.5-1 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Human
- Buffer:
- PBS, 2% Sucrose, 0.09% Sodium azide.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human A2BP1 (SAQTVSGTATQTDDAAPTDGQPQTQPSENTENKSQPKRLHVSNIPFRFRD).
- Uniprot:
- Q9NWB1
- Synonyms:
- 2BP1;A2BP1;ataxin 2-binding protein 1;Ataxin-2-binding protein 1;FOX-1;fox-1 homolog A;fox-1-like RNA-binding protein 1;FOX1;hexaribonucleotide-binding protein 1;HRNBP1;RNA binding protein fox-1 homolog 1;RNA binding protein, fox-1 homolog 1
- Extra Details:
- The Fox-1 family of RNA-binding proteins is evolutionarily conserved, and regulates tissue-specific alternative splicing in metazoa. Fox-1 recognizes a (U)GCAUG stretch in regulated exons or in flanking introns. The protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the product of the SCA2 gene which causes familial neurodegenerative diseases. Fox-1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
- Shipping Conditions:
- Blue Ice
