GTX16638
Kv1.6 antibody
Cannot supply to this region.
- SKU:
- GTX16638
- Additional Names:
- potassium voltage-gated channel subfamily A member 6 , Kv1.6
- Application:
- IHC, WB, IF, ICC
- Concentration:
- 0.3 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human, Rat
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- PBS, 1% BSA, 5% Sucrose, 0.025% Sodium azide.
- Immunogen:
- GST fusion protein with a sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASRERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463-530 (Intracellular, C-terminus) of rat KV1.6 (Accession : P17659), (MW: 35 kDa.).
- Synonyms:
- Kv1.6;kv2;potassium channel-Kv2;potassium channel, voltage gated shaker related subfamily A, member 6;potassium voltage gated channel, shaker related subfamily, member 6;potassium voltage-gated channel subfamily A member 6;RCK2;voltage-gated potassium channel subunit Kv1.6;voltage-gated potassium channel subunit Kv2
- Extra Details:
- voltage-gated potassium channel [RGD, Feb 2006]
- Shipping Conditions:
- Blue Ice