GTX13321
IL21 Receptor antibody
Cannot supply to this region.
- SKU:
- GTX13321
- Additional Names:
- CD360,IL21R,NILR,interleukin 21 receptor,IL21-R,IL21 Receptor
- Application:
- ELISA, IHC
- Concentration:
- 1 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Goat
- Reactivities:
- Human, Mouse
- Buffer:
- 10mM KHPO₄, 140mM NaCl, 0.1% BSA, 0.1% Sodium azide.
- Immunogen:
- Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to 35-65 residues of N-terminus of human IL-21 receptor.
- Uniprot:
- Q9HBE5
- Synonyms:
- CD360;IL-21 receptor;IMD56;interleukin-21 receptor;NILR;novel interleukin receptor
- Extra Details:
- The protein encoded by this gene is a cytokine receptor for interleukin 21 (IL21). It belongs to the type I cytokine receptors, and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2, 4, 7, 9, and 15. This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3. Knockout studies of a similar gene in mouse suggest a role for this gene in regulating immunoglobulin production. Three alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2010]
- Shipping Conditions:
- Blue Ice