GTX05139
METTL24 Antibody
Cannot supply to this region.
- SKU:
- GTX05139
- Application:
- WB
- Concentration:
- 0.5 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Human
- Buffer:
- PBS, 2% Sucrose, 0.09% Sodium azide.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the C-terminal region of Human METTL24: EWKVLENLILEDVLEQIGQLIFEIHLHWPGFEVSGSDSSVVRFWYSLLKE
- Uniprot:
- Q5JXM2
- Synonyms:
- C6orf186;methyltransferase-like protein 24;UPF0624 protein C6orf186
- Shipping Conditions:
- Blue Ice