GTX04975
NHE3 antibody
Cannot supply to this region.
- SKU:
- GTX04975
- Additional Names:
- DIAR8,NHE3,SLC9A3,solute carrier family 9 member A3,Hydrogen Exchanger 3
- Application:
- WB
- Concentration:
- 0.5 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Human
- Buffer:
- PBS, 2 % Sucrose, 0.09% Sodium Azide.
- Immunogen:
- A synthetic peptide directed towards the middle region of human SLC9A3: AEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR
- Uniprot:
- P48764
- Synonyms:
- DIAR8;Na(+)/H(+) exchanger 3;NHE-3;NHE3;sodium/hydrogen exchanger 3;solute carrier family 9 (sodium/hydrogen exchanger), member 3;Solute carrier family 9 member 3;solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3
- Extra Details:
- The protein encoded by this gene is an epithelial brush border Na/H exchanger that uses an inward sodium ion gradient to expel acids from the cell. Defects in this gene are a cause of congenital secretory sodium diarrhea. Pseudogenes of this gene exist on chromosomes 10 and 22. [provided by RefSeq, Mar 2016]
- Shipping Conditions:
- Blue Ice