GTX04957
GATSL3 antibody
Cannot supply to this region.
- SKU:
- GTX04957
- Additional Names:
- CASTOR1,GATS protein like 3,GATSL3,cytosolic arginine sensor for mTORC1 subunit 1
- Application:
- WB
- Concentration:
- 0.5 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Human
- Buffer:
- PBS, 2% sucrose, 0.09% Sodium Azide.
- Immunogen:
- A synthetic peptide directed towards the C-terminal region of Human GATSL3 protein: EPSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGG
- Uniprot:
- Q8WTX7
- Synonyms:
- cellular arginine sensor for mTORC1 protein 1;cytosolic arginine sensor for mTORC1 subunit 1;GATS protein like 3;GATS-like protein 3;GATSL3
- Shipping Conditions:
- Blue Ice