GTX04842
ZXDA antibody

Cannot supply to this region.
- SKU:
- GTX04842
- Additional Names:
- ZNF896,ZXDA,zinc finger, Xlinked, duplicated A,zinc finger X-linked duplicated A
- Application:
- WB
- Concentration:
- 0.5 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Human
- Buffer:
- PBS, 2% Sucrose, 0.09% Sodium Azide.
- Immunogen:
- A synthetic peptide directed towards the middle region of human ZXDA, within the following region: PAKAEWSVHPNSDFFGQEGETQFGFPNAAGNHGSQKERNLITVTGSSFLV.
- Uniprot:
- P98168
- Synonyms:
- zinc finger protein 896;zinc finger X-linked protein ZXDA;ZNF896
- Shipping Conditions:
- Blue Ice
