GTX04825
Transcobalamin 2 antibody
Cannot supply to this region.
- SKU:
- GTX04825
- Application:
- WB
- Concentration:
- 0.5 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Mouse
- Buffer:
- PBS, 2% Sucrose, 0.09% Sodium Azide.
- Immunogen:
- A synthetic peptide corresponding to a region of Mouse: PWMDRLSSEQLNPSVFVGLRLSSMQAGTKEDLYLHSLKIHYQQCLLRSTS
- Uniprot:
- O88968
- Synonyms:
- AW208754;TC II;TC-2;TCII;Tcn-;Tcn-2;transcobalamin II;transcobalamin-2
- Shipping Conditions:
- Blue Ice