GTX04627
CHMP4C antibody
Cannot supply to this region.
- SKU:
- GTX04627
- Additional Names:
- charged multivesicular body protein 4C , 2010012P02Rik , 2210015K02Rik , 2310010I16Rik , Shax3 , Snf7-3
- Application:
- WB
- Concentration:
- 0.5 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Mouse
- Buffer:
- PBS, 2% sucrose, 0.09% sodium azide.
- Immunogen:
- A synthetic peptide directed towards the C-terminal region of Mouse Chmp4c: SEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA
- Uniprot:
- Q9D7F7
- Synonyms:
- 2010012P02Rik;2210015K02Rik;2310010I16Rik;charged multivesicular body protein 4c;chromatin modifying protein 4C;chromatin-modifying protein 4c;Shax3;Snf7;Snf7 homologue associated with Alix 3;Snf7-3
- Extra Details:
- Predicted to enable protein homodimerization activity. Predicted to be involved in several processes, including proteolysis involved in protein catabolic process; regulation of cell cycle process; and vacuolar transport. Predicted to be located in several cellular components, including Flemming body; bounding membrane of organelle; and kinetochore microtubule. Predicted to be part of ESCRT III complex and nuclear pore. Predicted to be active in cytoplasmic side of plasma membrane and multivesicular body. Is expressed in several structures, including alimentary system; cardiovascular system; genitourinary system; lung; and lymph node. Orthologous to human CHMP4C (charged multivesicular body protein 4C). [provided by Alliance of Genome Resources, Jul 2025]
- Shipping Conditions:
- Blue Ice