GTX04582
TMEM26 antibody
Cannot supply to this region.
- SKU:
- GTX04582
- Additional Names:
- transmembrane protein 26
- Application:
- WB, IHC-P
- Concentration:
- 0.5 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Human
- Buffer:
- PBS, 2% sucrose, 0.09% sodium azide.
- Immunogen:
- A synthetic peptide directed towards the C-terminal region of Human TMEM26 (RSQSEGLKGEHGCRAQTSESGPSQRDWQNESKEGLAIPLRGSPVTSDDSH)
- Uniprot:
- Q6ZUK4
- Synonyms:
- transmembrane protein 26
- Extra Details:
- This gene encodes a protein containing multiple transmembrane helices. It is a selective surface protein marker of brite/beige adipocytes, which may coexist with classical brown adipocytes in brown adipose tissue. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2015]
- Shipping Conditions:
- Blue Ice