GTX04091
TMEM166 antibody
Cannot supply to this region.
- SKU:
- GTX04091
- Additional Names:
- eva-1 homolog A, regulator of programmed cell death , FAM176A , TMEM166
- Application:
- Flow Cytometry, WB, IHC-P, IF, ICC
- Concentration:
- 5 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- 4mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg sodium azide.
- Immunogen:
- A synthetic peptide corresponding to a sequence of human TMEM166/EVA1A (MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA).
- Uniprot:
- Q9H8M9
- Synonyms:
- FAM176A;family with sequence similarity 176, member A;protein eva-1 homolog A;protein FAM176A;TMEM166;transmembrane protein 166
- Shipping Conditions:
- Blue Ice