Rab11A antibody [4H9]

Cannot supply to this region.

SKU:: GTX03669
Additional Names:: RAB11A, member RAS oncogene family , YL8
Application:: Flow Cytometry, WB, IHC-P, IF, ICC
Concentration:: 0.5 mg/ml
Physical State:: Liquid
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
Supplier:: Genetex
Host:: Mouse
Reactivities:: Human, Mouse, Rat
Buffer:: 4mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄, no preservatives.
Immunogen:: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences.
Clone:: 4H9
Uniprot:: P62491
Synonyms:: RAB 11A, member oncogene family;rab-11;ras-related protein Rab-11A;YL8
Extra Details:: The protein encoded by this gene belongs to the Rab family of the small GTPase superfamily. It is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]