GTX02780
Interferon gamma Receptor 1 antibody
Cannot supply to this region.
- SKU:
- GTX02780
- Additional Names:
- interferon gamma receptor 1 , CD119 , IFNGR , IMD27A , IMD27B
- Application:
- Flow Cytometry, WB, IHC-Fr, IF, ICC
- Concentration:
- 0.5 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Human
- Buffer:
- 4mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg Sodium azide.
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-terminus of human IFNGR1 (443-484aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids.
- Uniprot:
- P15260
- Synonyms:
- antiviral protein, type 2;AVP, type 2;CD119;CD119 antigen;CDw119;IFN-gamma receptor 1;IFN-gamma-R-alpha;IFN-gamma-R1;IFNGR;IMD27A;IMD27B;immune interferon receptor 1;interferon gamma receptor 1;Interferon gamma receptor alpha-chain;interferon-gamma receptor alpha chain
- Extra Details:
- This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection. [provided by RefSeq, Jul 2008]
- Shipping Conditions:
- Blue Ice