GTX00643
HtrA1 antibody
Cannot supply to this region.
- SKU:
- GTX00643
- Additional Names:
- ARMD7 , CADASIL2 , CARASIL , HTRA1 , HtrA , HtrA serine peptidase 1 , L56 , ORF480 , PRSS11 , HtrA1
- Application:
- WB, IHC-P
- Concentration:
- 0.5 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- 4mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg Sodium azide.
- Immunogen:
- A synthetic peptide corresponding to a sequence of human HTRA1 (QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD).
- Uniprot:
- Q92743
- Synonyms:
- ARMD7;CADASIL2;CARASIL;high-temperature requirement A serine peptidase 1;HtrA;IGFBP5-protease;L56;ORF480;protease, serine, 11 (IGF binding);PRSS11;Serine protease 11;serine protease HTRA1
- Extra Details:
- This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7. [provided by RefSeq, Jul 2008]
- Shipping Conditions:
- Blue Ice