ORB705334
Human ICOSLG protein
Cannot supply to this region.
- SKU:
- ORB705334
- Additional Names:
- B7 homolog 2 (B7-H2) (B7-like protein Gl50) (B7-related protein 1) (B7RP-1)
- Molecular Weight:
- 28.9 kDa
- Purity:
- Greater than 93% as determined by SDS-PAGE.
- Source:
- Mammalian cell
- Research Area:
- Cancer Biology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
- Format:
- Lyophilized powder
- Sequence:
- DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS
- Shipping Conditions:
- Blue Ice