ORB705305
Human GDF7 protein
Cannot supply to this region.
- SKU:
- ORB705305
- Additional Names:
- GDF-7, BMP12
- Molecular Weight:
- 14.0 kDa
- Purity:
- > 95 % as determined by SDS-PAGE and HPLC analyses.
- Source:
- E.Coli
- Research Area:
- Signal Transduction
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 µm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.
- Format:
- Lyophilized powder
- Sequence:
- TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
- Shipping Conditions:
- Blue Ice