ORB705269
Human PLAU protein
Cannot supply to this region.
- SKU:
- ORB705269
- Additional Names:
- ATF, ATF uPA, BDPLT5, Plasminogen activator, Plasminogen activator urinary, Plasminogen activator urokinase, PLAU, QPD, u PA, U plasminogen activator, u-PA, U-plasminogen activator, uPA, URK, UROK_HUMAN, Urokinase plasminogen activator, Urokinase type plasminogen activator, Urokinase type plasminogen activator precursor, Urokinase-type plasminogen activator chain B
- Molecular Weight:
- 52.4 kDa
- Purity:
- Greater than 85% as determined by SDS-PAGE.
- Source:
- E.coli
- Research Area:
- Cardiovascular Research
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Format:
- Liquid or Lyophilized powder
- Sequence:
- SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
- Shipping Conditions:
- Blue Ice