Human COL4A1 protein

Cannot supply to this region.

SKU:: ORB704603
Additional Names:: Arresten, BSVD, CO4A1_HUMAN, COL4A1, COL4A1 NC1 domain, COL4A2, COL4A3, COL4A4, COL4A5, collagen alpha-1(IV) chain, Collagen IV Alpha 1 Polypeptide, Collagen IV Alpha 2 Polypeptide, Collagen Of Basement Membrane Alpha 1 Chain, Collagen Of Basement Membrane Alpha 2 Chain, Collagen Type IV Alpha 1, collagen type IV alpha 1 chain, Collagen Type IV Alpha 2, Collagen Type IV Alpha 3, Collagen Type IV Alpha 4, Collagen Type IV Alpha 5, RATOR
Molecular Weight:: 39.9 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Cardiovascular Research
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: GCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVP