Human CD48 protein

Cannot supply to this region.

SKU:: ORB624104
Additional Names:: B-lymphocyte activation marker BLAST-1 (BCM1 surface antigen) (Leukocyte antigen MEM-102) (SLAM family member 2) (SLAMF2) (Signaling lymphocytic activation molecule 2) (TCT.1) (CD48) (BCM1) (BLAST1)
Molecular Weight:: 51.3 kDa
Purity:: Greater than 95% as determined by SDS-PAGE.
Source:: Mammalian cell
Research Area:: Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Format:: Lyophilized powder
Sequence:: QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS