Human BSG protein

Cannot supply to this region.

SKU:: ORB624100
Additional Names:: 5A11 antigen, 5F7, BASI_HUMAN, Basigin (Ok blood group), Basigin, Blood brain barrier HT7 antigen, Bsg, CD 147, CD147, CD147 antigen, Collagenase stimulatory factor, EMMPRIN, Extracellular matrix metalloproteinase inducer, Leukocyte activation antigen M6, M 6, M6, M6 leukocyte activation antigen, Neurothelin, OK, OK blood group, OK blood group antigen, TCSF, Tumor cell derived collagenase stimulatory factor, Tumor cell-derived collagenase stimulatory factor
Molecular Weight:: 24.9 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: Mammalian cell
Research Area:: Cell Biology
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA