ORB605377
Human REL protein
Cannot supply to this region.
- SKU:
- ORB605377
- Additional Names:
- Avian reticuloendotheliosis , C REL, C Rel protein, c Rel proto oncogene protein, Oncogene REL , Oncogene REL avian reticuloendotheliosis, Proto-oncogene c-Rel, REL, REL_HUMAN, v rel avian reticuloendotheliosis viral oncogene homolog, v rel reticuloendotheliosis viral oncogene homolog , V rel reticuloendotheliosis viral oncogene homolog (avian)
- Molecular Weight:
- 66.6 kDa
- Purity:
- Greater than 85% as determined by SDS-PAGE.
- Source:
- Yeast
- Research Area:
- Cancer Biology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Format:
- Liquid or Lyophilized powder
- Sequence:
- SGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEF
- Shipping Conditions:
- Blue Ice