Human CXCL8 protein

Cannot supply to this region.

SKU:: ORB605346
Additional Names:: C-X-C motif chemokine 8 Chemokine (C-X-C motif) ligand 8 Emoctakin Granulocyte chemotactic protein 1 Short name, GCP-1 Monocyte-derived neutrophil chemotactic factor Short name, MDNCF Monocyte-derived neutrophil-activating peptide Short name, MONAP Neutrophil-activating protein 1 Short name, NAP-1 Protein 3-10C T-cell chemotactic factor IL8
Molecular Weight:: 10.9 kDa
Purity:: Greater than 85% as determined by SDS-PAGE.
Source:: Yeast
Research Area:: Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS