Human CSF1 protein

Cannot supply to this region.

SKU:: ORB605310
Additional Names:: Macrophage colony-stimulating factor 1; CSF-1; M-CSF; MCSF; Lanimostim; Proteoglycan macrophage colony-stimulating factor; Processed macrophage colony-stimulating factor 1; Macrophage colony-stimulating factor 1 43 kDa subunit; CSF1
Molecular Weight:: 19.9 kDa
Purity:: Greater than 95% as determined by SDS-PAGE.
Source:: Yeast
Research Area:: Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Lyophilized powder
Sequence:: EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN