ORB605229
Human KLRK1 protein
Cannot supply to this region.
- SKU:
- ORB605229
- Additional Names:
- Killer cell lectin-like receptor subfamily K member 1 (NK cell receptor D) (NKG2-D-activating NK receptor) (CD314)
- Molecular Weight:
- 43.6 kDa
- Purity:
- Greater than 93% as determined by SDS-PAGE.
- Source:
- Mammalian cell
- Research Area:
- Immunology & Inflammation
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
- Format:
- Lyophilized powder
- Sequence:
- FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
- Shipping Conditions:
- Blue Ice