Human CTAG1A protein

Cannot supply to this region.

SKU:: ORB605210
Additional Names:: CTAG1A, CTAG1B, Autoimmunogenic cancer/testis antigen NY ESO 1, Autoimmunogenic cancer/testis antigen NY-ESO-1, Cancer antigen 3, Cancer/testis antigen 1, Cancer/testis antigen 1B , Cancer/testis antigen 6.1, CT6.1, CTAG 1, CTAG 1B, CTAG, CTAG1, CTAG1B, CTG1B_HUMAN, ESO 1, ESO1, L antigen family member 2, LAGE 2, LAGE 2 protein, LAGE 2B, LAGE-2, LAGE2, LAGE2 protein, LAGE2A, LAGE2B, New York esophageal squamous cell carcinoma 1, NY ESO 1, NYESO 1, NYESO1
Molecular Weight:: 48.1 kDa
Purity:: Greater than 85% as determined by SDS-PAGE.
Source:: Mammalian cell
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR