ORB605194
Human BSG protein

Cannot supply to this region.
- SKU:
- ORB605194
- Additional Names:
- 5A11 antigen, 5F7, BASI_HUMAN, Basigin (Ok blood group), Basigin, Blood brain barrier HT7 antigen, Bsg, CD 147, CD147, CD147 antigen, Collagenase stimulatory factor, EMMPRIN, Extracellular matrix metalloproteinase inducer, Leukocyte activation antigen M6, M 6, M6, M6 leukocyte activation antigen, Neurothelin, OK, OK blood group, OK blood group antigen, TCSF, Tumor cell derived collagenase stimulatory factor, Tumor cell-derived collagenase stimulatory factor
- Molecular Weight:
- 49.3 kDa
- Purity:
- Greater than 85% as determined by SDS-PAGE.
- Source:
- Mammalian cell
- Research Area:
- Cell Biology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Format:
- Liquid or Lyophilized powder
- Sequence:
- EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA
- Shipping Conditions:
- Blue Ice
