Human MOG protein

Cannot supply to this region.

SKU:: ORB604902
Additional Names:: BTN6, BTNL11, MGC26137, MOG alpha 5, MOG alpha 6, MOG AluA, MOG AluB, MOG, MOG Ig AluB, MOG_HUMAN, MOGIG2, Myelin oligodendrocyte glycoprotein, Myelin-oligodendrocyte glycoprotein, NRCLP7
Molecular Weight:: 17.9 kDa
Purity:: Greater than 85% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Signal Transduction
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG