ORB604713
Human HLA-DQB1 protein
Cannot supply to this region.
- SKU:
- ORB604713
- Additional Names:
- CELIAC1, DQ beta 1 chain, DQB1_HUMAN, HLA class II histocompatibility antigen, HLA class II histocompatibility antigen, DQ beta 1 chain, HLA class II histocompatibility antigen, DQ beta 2 chain, HLA DQB, HLA DQB1, HLA-DQB1, HLA-DQB2, IDDM1, Lymphocyte antigen, Major histocompatibility complex class II beta, Major histocompatibility complex, class II, DQ beta 1, MHC class II antigen DQB1, MHC class II antigen HLA DQ beta 1, MHC class II DQ beta chain, MHC class II HLA DQ beta glycoprotein, MHC class2 antigen, MHC DQ beta, OTTHUMP00000029167, OTTHUMP00000178569, OTTHUMP00000178570, OTTHUMP00000178571
- Molecular Weight:
- 27 kDa
- Purity:
- Greater than 85% as determined by SDS-PAGE.
- Source:
- E.coli
- Research Area:
- Cell Biology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Format:
- Liquid or Lyophilized powder
- Sequence:
- RDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESA
- Shipping Conditions:
- Blue Ice