Virus genotype 1a Genome polyprotein protein

Cannot supply to this region.

SKU:: ORB604644
Additional Names:: Genome polyprotein [Cleaved into, Core protein p21, Capsid protein C, p21), Core protein p19, Envelope glycoprotein E1, gp32, gp35), Envelope glycoprotein E2, NS1, gp68, gp70), p7, Protease NS2-3, p23, EC 3.4.22.-), Serine protease NS3, EC 3.4.21.98, EC 3.6.1.15, EC 3.6.4.13, Hepacivirin, NS3P, p70), Non-structural protein 4A, NS4A, p8), Non-structural protein 4B, NS4B, p27), Non-structural protein 5A, NS5A, p56), RNA-directed RNA polymerase, EC 2.7.7.48, NS5B, p68)]
Molecular Weight:: 30.7 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Infectious Disease & Virology
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: YQVRNSTGLYHVTNDCPNSSIVYEAADAILHTPGCVPCVREGNASRCWVAMTPTVATRDGKLPATQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRRHWTTQGCNCSIYPGHITGHRMAWDMMMN