Human TGF beta 1 protein

Cannot supply to this region.

SKU:: ORB604408
Additional Names:: Cartilage-inducing factor, CED, Differentiation inhibiting factor, DPD1, LAP, Latency-associated peptide, Prepro transforming growth factor beta 1, TGF beta 1, TGF beta, TGF beta 1 protein, TGF-beta 1 protein, TGF-beta-1, TGF-beta-5, TGF-beta1, TGFB, Tgfb-1, tgfb1, TGFB1_HUMAN, TGFbeta, TGFbeta1, Transforming Growth Factor b1, Transforming Growth Factor beta 1, Transforming growth factor beta 1a, transforming growth factor beta-1, transforming growth factor, beta 1, Transforming Growth Factor-?
Molecular Weight:: 16.6 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Signal Transduction
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS