Human IL3 protein

Cannot supply to this region.

SKU:: ORB604192
Additional Names:: Interleukin-3; IL-3;Hematopoietic growth factor; Mast cell growth factor (MCGF); Multipotential colony-stimulating factor; P-cell-stimulating factor; IL3
Molecular Weight:: 22.0 kDa
Purity:: Greater than 95% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Format:: Lyophilized powder
Sequence:: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF