Human COL18A1 protein

Cannot supply to this region.

SKU:: ORB603983
Additional Names:: Alpha 1 collagen type 18 (XVIII)(COL18A1), Alpha 1 type XVIII collagen, Antiangiogenic agent, COIA1_HUMAN, COL15A1, Col18a1, Collagen alpha 1(XV) chain, Collagen alpha 1(XVIII) chain, Collagen alpha-1(XV) chain, Collagen type XV proteoglycan, Collagen type XVIII alpha 1, Collagen XV, alpha 1 polypeptide, Collagen, type XV, alpha 1, Endostatin, Endostatin XV, FLJ27325, FLJ34914, FLJ38566, KNO, KNO1, KS, MGC74745, Multi functional protein MFP, OTTHUMP00000021782, OTTHUMP00000115472, OTTHUMP00000115473
Molecular Weight:: 46.3 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Cell Biology
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK