Human CD63 protein

Cannot supply to this region.

SKU:: ORB603972
Additional Names:: Granulophysin Lysosomal-associated membrane protein 3 Short name, LAMP-3 Melanoma-associated antigen ME491 OMA81H Ocular melanoma-associated antigen Tetraspanin-30 Short name, Tspan-30 CD_antigen, CD63 MLA1, TSPAN30
Molecular Weight:: 15.5 kDa
Purity:: Greater than 85% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV