Human BCL2 protein

Cannot supply to this region.

SKU:: ORB603931
Additional Names:: Apoptosis regulator Bcl 2, Apoptosis regulator Bcl-2, Apoptosis regulator Bcl2, AW986256, B cell CLL/lymphoma 2, B cell leukemia/lymphoma 2, Bcl-2, Bcl2, BCL2_HUMAN, C430015F12Rik, D630044D05Rik, D830018M01Rik, Leukemia/lymphoma, B-cell, 2, Oncogene B-cell leukemia 2, PPP1R50, Protein phosphatase 1 regulatory subunit 50, Protein phosphatase 1, regulatory subunit 50
Molecular Weight:: 25.2 kDa
Purity:: Greater than 85% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Cell Biology
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD