Human ARID1A protein

Cannot supply to this region.

SKU:: ORB594954
Additional Names:: B120 BRG1-associated factor 250 Short name, BAF250 BRG1-associated factor 250a Short name, BAF250A Osa homolog 1 Short name, hOSA1 SWI-like protein SWI/SNF complex protein p270 SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1 hELD C1orf4, OSA1, SMARCF1
Molecular Weight:: 32.4 kDa
Purity:: Greater than 85% as determined by SDS-PAGE.
Source:: Baculovirus
Research Area:: Epigenetics & Chromatin
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMM