Human ACVR2B protein

Cannot supply to this region.

SKU:: ORB594924
Additional Names:: Activin Receptor Type-2B; Activin Receptor Type IIB; ACTR-IIB; ACVR2B
Molecular Weight:: 41.3 kDa
Purity:: Greater than 95% as determined by SDS-PAGE.
Source:: Mammalian cell
Research Area:: Signal Transduction
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 10% Trehalose, 3% Mannitol, 0.05% Tween 80, 10 mM Methionine, pH 8.5.
Format:: Lyophilized powder
Sequence:: SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT