ORB594918
Human CA5B protein

Cannot supply to this region.
- SKU:
- ORB594918
- Additional Names:
- Carbonic Anhydrase 5B Mitochondrial; Carbonate Dehydratase VB; Carbonic Anhydrase VB; CA-VB; CA5B
- Molecular Weight:
- 33.77 kDa
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Source:
- E.coli
- Research Area:
- Signal Transduction
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- 0.2 μm filtered 20 mM Tris-HCl, 100 mM NaCl, pH 8.0
- Format:
- Liquid
- Sequence:
- CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
- Shipping Conditions:
- Blue Ice
