ORB594850
Human TNFRSF10C protein

Cannot supply to this region.
- SKU:
- ORB594850
- Additional Names:
- Tumor Necrosis Factor Receptor Superfamily Member 10C; Antagonist Decoy Receptor for TRAIL/Apo-2L; Decoy TRAIL Receptor Without Death Domain; Decoy Receptor 1; DcR1; Lymphocyte Inhibitor of TRAIL; TNF-Related Apoptosis-Inducing Ligand Receptor 3; TRAIL Receptor 3; TRAIL-R3; TRAIL Receptor Without an Intracellular Domain; CD263; TNFRSF10C; DCR1; LIT; TRAILR3; TRID
- Molecular Weight:
- 21.78 kDa
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Source:
- Mammalian cell
- Research Area:
- Cell Biology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
- Format:
- Lyophilized powder
- Sequence:
- ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA
- Shipping Conditions:
- Blue Ice
