ORB594835
Mouse IL4 protein
Cannot supply to this region.
- SKU:
- ORB594835
- Additional Names:
- Interleukin-4;B-cell IgG differentiation factor;B-cell growth factor 1;B-cell stimulatory factor 1;IGG1 induction factor;Lymphocyte stimulatory factor 1;IL-4;BSF-1
- Molecular Weight:
- 13.4 kDa
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Source:
- E.coli
- Research Area:
- Immunology & Inflammation
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm filtered solution of 20mM PB, 300mM NaCl, 5% Trehalose, pH 6.5.
- Format:
- Lyophilized powder
- Sequence:
- HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
- Shipping Conditions:
- Blue Ice