Mouse Il17a protein

Cannot supply to this region.

SKU:: ORB594832
Additional Names:: Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17
Molecular Weight:: 16.2 kDa
Purity:: Greater than 95% as determined by SDS-PAGE.
Source:: Mammalian cell
Research Area:: Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 μm filtered solution of PBS,PH7.4.
Format:: Lyophilized powder
Sequence:: TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA