Mouse Il33 protein

Cannot supply to this region.

SKU:: ORB594779
Additional Names:: Interleukin 33; IL-33; IL33; C9orf26; NKHEV; Interleukin-1 family member 11; DVS27; NF-HEV and IL- 1F11
Molecular Weight:: 17.6 kDa
Purity:: Greater than 95% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Format:: Lyophilized powder
Sequence:: SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI