ORB594759
Human TGFB3 protein
Cannot supply to this region.
- SKU:
- ORB594759
- Additional Names:
- Transforming growth factor beta-3;TGFB3;TGF-beta-3;Latency-associated peptide;LAP
- Molecular Weight:
- 12.7 kDa
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Source:
- Mammalian cell
- Research Area:
- Cancer Biology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm filtered solution of 50mM Glycine-HCl, 150mM NaCl, pH 2.5.
- Format:
- Lyophilized powder
- Sequence:
- ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
- Shipping Conditions:
- Blue Ice