ORB594757
Human FGF8 protein
Cannot supply to this region.
- SKU:
- ORB594757
- Additional Names:
- Fibroblast growth factor 8;Androgen-induced growth factor;Heparin-binding growth factor 8;AIGF;HBGF-8;FGF-8B
- Molecular Weight:
- 22.5 kDa
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Source:
- E.coli
- Research Area:
- Stem Cell & Developmental Biology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
- Format:
- Lyophilized powder
- Sequence:
- QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
- Shipping Conditions:
- Blue Ice